PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN10739.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 294aa    MW: 33522.3 Da    PI: 4.9742
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN10739.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+++++ +   +W++ ++  g+ R++k+c++rw +yl
       KHN10739.1 14 RGPWTPEEDQILINYINTYDHANWRALPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding50.54.6e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++ ++ ++++lG++ W++Ia++++ gRt++++k+ w+++l
       KHN10739.1  67 RGNFTREEEDTIISLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129413.707961IPR017930Myb domain
SuperFamilySSF466891.31E-2910108IPR009057Homeodomain-like
SMARTSM007173.3E-131363IPR001005SANT/Myb domain
PfamPF002492.2E-141461IPR001005SANT/Myb domain
CDDcd001673.26E-101661No hitNo description
PROSITE profilePS5129425.11562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2665116IPR009057Homeodomain-like
SMARTSM007172.8E-1466114IPR001005SANT/Myb domain
PfamPF002494.0E-1567112IPR001005SANT/Myb domain
CDDcd001673.01E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTPE EDQILINYIN TYDHANWRAL PKLAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TREEEDTIIS LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLPQNY  120
KQSHDQKKRS KKQPKLDVDA SKSNQDAKLE QQQEPVNNNF PFHASNSEDM MPLSPPQCSS  180
HMSSSSLTTS DNNGSINNNH DMSLNVNDDI DTPENNLALD EDFWSEVLSS DNSGETTSGF  240
PTIDYDHQFL PMSPLMTEEG VLIDASSSSV CDDGMDFWCN VYARAEEFTQ LLEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9791360.0KC979136.1 Glycine max cultivar Jindou 21 MYB4-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003521289.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0B2PSZ00.0A0A0B2PSZ0_GLYSO; Myb-related protein Myb4
TrEMBLI1JP370.0I1JP37_SOYBN; Uncharacterized protein
STRINGGLYMA03G31980.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-83myb domain protein 14
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]